PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_012220-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 406aa    MW: 44563.9 Da    PI: 5.9751
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_012220-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.75.7e-183984147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg+W++eEd +l ++v ++G ++W++Iar ++ gR++k+c++rw + 
  AHYPO_012220-RA 39 RGPWSPEEDGILSELVSKFGARNWSLIARGIP-GRSGKSCRLRWCNQ 84
                     89******************************.***********985 PP

2Myb_DNA-binding53.26.7e-1791135147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++++eEd++++ a++ +G++ W+ Ia+ ++ gRt++ +k++w++ 
  AHYPO_012220-RA  91 RKPFSEEEDQIIITAHAIHGNK-WACIAKLLP-GRTDNAIKNHWNST 135
                      789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.4763485IPR017930Myb domain
SuperFamilySSF466891.11E-3038132IPR009057Homeodomain-like
SMARTSM007171.4E-143887IPR001005SANT/Myb domain
PfamPF002495.6E-173984IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-254092IPR009057Homeodomain-like
CDDcd001673.88E-144183No hitNo description
PROSITE profilePS5129425.08686140IPR017930Myb domain
SMARTSM007176.2E-1690138IPR001005SANT/Myb domain
PfamPF002494.1E-1591135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2393139IPR009057Homeodomain-like
CDDcd001672.43E-1293136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MSDQPMTTED PNDLALPDAV TIAVEGDEAA VTQPKCRVRG PWSPEEDGIL SELVSKFGAR  60
NWSLIARGIP GRSGKSCRLR WCNQLDPCVK RKPFSEEEDQ IIITAHAIHG NKWACIAKLL  120
PGRTDNAIKN HWNSTLRRRY DFVKSPGEGS TDRIKDSSEE TISGETTSLK AVDGRQDVNM  180
RDNQCHQSEY HASNTDNLPQ STQPEIEPLN MHPNHHFVVA HPPVFNSVIG PTPTEPPTLT  240
RPVARVGAFN VYQPDSDLTP AAPPPRPVPV RGPLVNAFPD FGISKFVDGV QCEPIIPSRC  300
GHGCCSTPTG FKSGTSLLGP EFIEYEEPPS FSSHELASIA TDLNNIAWIK SGLDSGCARR  360
TEYPLQRRDA QGADSSRQCT QKTDNVRFEE GRTKLMGMMT ELIST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-41381416109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010690407.10.0PREDICTED: uncharacterized protein LOC104903953
TrEMBLA0A0J8CXH10.0A0A0J8CXH1_BETVU; Uncharacterized protein
STRINGVIT_08s0007g01540.t011e-127(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.12e-96myb domain protein 109